l carnitine fatty acid metabolism The Role of l-carnitine in transport and β -oxidation in Functional mechanisms of L-carnitine: ①

Active Ingredients (Per Vial): GHK-Cu 50mg A copper-binding tripeptide studied for its role in collagen synthesis, cellular regeneration signaling, and extracellular matrix remodeling in laboratory research models

Product Name: IGF LR3 1mg Catalogue Number: IGF1LR3-1mg Molecular Formula: C400H625N111O115S9 Molecular Weight: 9117.60 g/mol Purity: 98% Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Form: Lyophilised Solid Usage and Storage: Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments

1c and Table 1)

Its like tuning up your metabolism to run at its peak performance, increasing the calories out side of the energy balance equation and improving body composition