can semaglutide cause sore throat In most people, RSV causes mild cold-like symptoms of cough, runny nose, throat, headache, decreased appetite, and fever that typically last less than 5 days. However, in older adults, RSV Ozempic Side Effects and Tips

Some of those reasons are temporary and harmless

Essential features of the form include: Enrollee information, capturing personal identification details

Lyophilized (freeze-dried) powder: Room temperature storage: stable for weeks to months depending on peptide Refrigerator storage (2-8 C): stable for months to over a year Freezer storage (-20 C): stable for years in some cases Keep sealed, dry, and away from light Moisture is the primary enemy of lyophilized peptides Reconstituted solution: Must be refrigerated at 2-8 C at all times Typical stability: 4-6 weeks for most peptides Never freeze reconstituted solutions Use bacteriostatic water (not sterile water) for multi-use vials Each needle puncture introduces contamination risk The difference in stability is dramatic

Labelled exendin-9 (DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC(Cy3)-NH2) was purchased from Cambridge Peptides